PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID NNU_017657-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; stem eudicotyledons; Proteales; Nelumbonaceae; Nelumbo
Family MYB
Protein Properties Length: 315aa    MW: 34702.9 Da    PI: 5.4427
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
NNU_017657-RAgenomeCASView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding57.43.4e-181461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT+eEde+lv+++k+ G g+W++ +++ g+ R++k+c++rw +yl
    NNU_017657-RA 14 KGPWTPEEDEILVEYIKKNGHGSWRSLPNHAGLFRCGKSCRLRWTNYL 61
                     79********************************************97 PP

2Myb_DNA-binding52.11.5e-1667110146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      rg++T++E++++++++  lG++ W++Ia+ ++ gRt++++k++w++
    NNU_017657-RA  67 RGPFTPDEEKIIIQLHGILGNR-WAAIASQLP-GRTDNEIKNFWNT 110
                      89********************.*********.***********98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.2E-25563IPR009057Homeodomain-like
PROSITE profilePS5129419.074961IPR017930Myb domain
SuperFamilySSF466891.65E-3111108IPR009057Homeodomain-like
SMARTSM007175.0E-151363IPR001005SANT/Myb domain
PfamPF002491.4E-161461IPR001005SANT/Myb domain
CDDcd001672.73E-121661No hitNo description
PROSITE profilePS5129425.66262116IPR017930Myb domain
Gene3DG3DSA:1.10.10.604.2E-2664116IPR009057Homeodomain-like
SMARTSM007173.9E-1666114IPR001005SANT/Myb domain
PfamPF002491.9E-1567111IPR001005SANT/Myb domain
CDDcd001675.07E-1269110No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009751Biological Processresponse to salicylic acid
GO:0009753Biological Processresponse to jasmonic acid
GO:0009909Biological Processregulation of flower development
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 315 aa     Download sequence    Send to blast
MGRAPCCDKQ GLKKGPWTPE EDEILVEYIK KNGHGSWRSL PNHAGLFRCG KSCRLRWTNY  60
LRPDIKRGPF TPDEEKIIIQ LHGILGNRWA AIASQLPGRT DNEIKNFWNT QLKKRLLCMG  120
LDPQTHTPSF PSCGPVATPS TSPSTRHMAQ WESARLEAEA RLSRESLLSN LQLSSTKAEV  180
DYFLRIWNSE VGESFRRLSG PDSTACQSPI SQVSSSTKWG SGSGLTTEVA PAMTGRLTTD  240
QPEEVECKNS KGGVDDLAAG SDCSISNEVN DSSDTSLQLL LDFPASDDMG FFQGQMDNFS  300
LLPNLLDECS FNSAP
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A4e-31121165108B-MYB
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00114ampDAPTransfer from AT3G61250Download
Motif logo
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010273106.10.0PREDICTED: myb-related protein 308-like
RefseqXP_010273105.10.0PREDICTED: myb-related protein 308-like
RefseqXP_010273103.10.0PREDICTED: myb-related protein 308-like
RefseqXP_010273102.10.0PREDICTED: myb-related protein 308-like
TrEMBLD7UC601e-151D7UC60_VITVI; Putative uncharacterized protein
STRINGVIT_15s0046g03190.t011e-150(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G61250.11e-115myb domain protein 17